PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G1132
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 293aa    MW: 33557.2 Da    PI: 5.9952
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G1132genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.5e-192370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  l  +v+ +G g+W+++ar  g++Rt+k+c++rw++y+
      Gh_D11G1132 23 KGPWTEEEDSMLRAYVNIHGEGRWNAVARLSGLRRTGKSCRLRWLNYM 70
                     79********************************************97 PP

2Myb_DNA-binding50.35.6e-1676119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ + eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
      Gh_D11G1132  76 RGNISLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 119
                      78899*****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.6981874IPR017930Myb domain
SuperFamilySSF466897.11E-3120117IPR009057Homeodomain-like
SMARTSM007171.6E-162272IPR001005SANT/Myb domain
PfamPF002499.1E-172369IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-232477IPR009057Homeodomain-like
CDDcd001671.44E-112570No hitNo description
SMARTSM007171.2E-1475123IPR001005SANT/Myb domain
PROSITE profilePS5129419.47975125IPR017930Myb domain
PfamPF002499.5E-1576119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-2278124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MDVYKRGFIS ETSRSEEEME LRKGPWTEEE DSMLRAYVNI HGEGRWNAVA RLSGLRRTGK  60
SCRLRWLNYM RPEIKRGNIS LEEQLLILEL HSRWGNRWSK IAQHLPGRTD NEIKNYWRTR  120
VQKQAKQLNC DVNSKQFKDA MRYVWIPRLV ERIRASSESP SSQPSTTTNT TYNDRISNIS  180
SSQMSYANAS GSVQVDPSLL PELSGTSSDS LDTQVSSVSD LTDCYNPQSL SNYLHKGLGL  240
EKEGAATWGR DEEFQATEEH SNGWLVGGGE SSMDTVWNEE NVWFLQQQLH DGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-262012524128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO29213370.0
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0341330.0AF034133.1 Gossypium hirsutum MYB-like DNA-binding domain protein (MYB5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490294.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE14e-75MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D2SIH20.0A0A0D2SIH2_G
TrEMBLQ94JN50.0Q94JN5_G
STRINGPOPTR_0002s19250.11e-104(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.19e-78myb domain protein 78